PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.O00415.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 235aa    MW: 25701.8 Da    PI: 5.1291
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.O00415.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB122.32e-3860152294
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       r+ d+++Pian++rim++vlP++a i++dake +qe vsefisfvt+ea+  c+ + r+t++++d+l a+a+lG++dy+epl+++l+k+r  +
  Migut.O00415.1.p  60 RDVDQYMPIANITRIMRRVLPSHAEIADDAKEAIQEYVSEFISFVTAEANWLCHCDYRRTVTPEDVLAAMASLGLDDYLEPLTLFLNKHRAEQ 152
                       788**************************************************************************************9754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.5E-3755156IPR009072Histone-fold
SuperFamilySSF471139.19E-3063156IPR009072Histone-fold
PfamPF008081.2E-1965129IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-1193111No hitNo description
PRINTSPR006151.5E-11112130No hitNo description
PRINTSPR006151.5E-11131149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEKGGCSNIE YKYTRRARTS GIVIREGGVA SAAASTNATN IPAAAPNTIG GQVNQQGFKR  60
DVDQYMPIAN ITRIMRRVLP SHAEIADDAK EAIQEYVSEF ISFVTAEANW LCHCDYRRTV  120
TPEDVLAAMA SLGLDDYLEP LTLFLNKHRA EQNSEQFVRQ GGDAGVRVGF IDKQQPPMAS  180
TMGYYVPLPP SAATTKEERD FGDLTPAIHE YILRNHGCGE GSSGGCEFDP FQKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3060149392NF-YB
4awl_B2e-3060149493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-3060149493NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012839441.11e-135PREDICTED: nuclear transcription factor Y subunit B-3-like
TrEMBLA0A022R5831e-133A0A022R583_ERYGU; Uncharacterized protein (Fragment)
STRINGVIT_19s0015g00580.t013e-39(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6044436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.29e-41nuclear factor Y, subunit B6